![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
![]() | Protein automated matches [226991] (5 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:261594] [255873] (2 PDB entries) |
![]() | Domain d3hylb3: 3hyl B:528-666 [246619] Other proteins in same PDB: d3hyla1, d3hyla2, d3hylb1, d3hylb2 automated match to d1itza3 complexed with cl, fmt, gol, mg, peg, so4 |
PDB Entry: 3hyl (more details), 2.16 Å
SCOPe Domain Sequences for d3hylb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hylb3 c.48.1.0 (B:528-666) automated matches {Bacillus anthracis [TaxId: 261594]} egakddtyekvakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmp smdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgeki meeygftvenvvrkvkeml
Timeline for d3hylb3: