Lineage for d3hupb_ (3hup B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059Protein automated matches [190329] (10 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187151] (10 PDB entries) 
Domain d3hupb_: 3hup B: [177851]
automated match to d1fm5a_
complexed with cl, na
Details for d3hupb_
PDB Entry: 3hup (more details), 1.37 Å
PDB Description: High-resolution structure of the extracellular domain of human CD69
PDB Compounds: (B:) early activation antigen cd69SCOPe Domain Sequences for d3hupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hupb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
SCOPe Domain Coordinates for d3hupb_:
Click to download the PDB-style file with coordinates for d3hupb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hupb_:
- d3hupb_ first appeared in SCOPe 2.01
- d3hupb_ appears in SCOPe 2.07
View in 3D
