Lineage for d3ht5a_ (3ht5 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1693973Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1693974Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1694057Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1694058Protein automated matches [190815] (9 species)
    not a true protein
  7. 1694077Species Mycobacterium tuberculosis [TaxId:1773] [232507] (1 PDB entry)
  8. 1694078Domain d3ht5a_: 3ht5 A: [232508]
    automated match to d2coib_
    complexed with pmp

Details for d3ht5a_

PDB Entry: 3ht5 (more details), 1.9 Å

PDB Description: crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis
PDB Compounds: (A:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3ht5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ht5a_ e.17.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
pglgvrpatqyrylliaspagayfkggiapvsvwvsteyvracpggtgaakfggnyaasl
laqaeaaengcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitr
dsllqlaidagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefri
adgqpgevtmalrdtltgiqrgtfadthgwmarlg

SCOPe Domain Coordinates for d3ht5a_:

Click to download the PDB-style file with coordinates for d3ht5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ht5a_: