Lineage for d3hssb_ (3hss B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (71 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries) 
Domain d3hssb_: 3hss B: [232506]
automated match to d1a88a_
complexed with act, edo, mla, na, trs
Details for d3hssb_
PDB Entry: 3hss (more details), 1.9 Å
PDB Description: a higher resolution structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
PDB Compounds: (B:) putative BromoperoxidaseSCOPe Domain Sequences for d3hssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hssb_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvka
SCOPe Domain Coordinates for d3hssb_:
Click to download the PDB-style file with coordinates for d3hssb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hssb_:
- d3hssb_ first appeared in SCOPe 2.03
- d3hssb_ appears in SCOPe 2.04
- d3hssb_ appears in SCOPe 2.06
- d3hssb_ appears in the current release, SCOPe 2.08
View in 3D
