Lineage for d3hjua_ (3hju A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (131 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries) 
Domain d3hjua_: 3hju A: [264830]
automated match to d3pe6a_
complexed with gol
Details for d3hjua_
PDB Entry: 3hju (more details), 2.2 Å
PDB Description: Crystal structure of human monoglyceride lipase
PDB Compounds: (A:) Monoglyceride lipaseSCOPe Domain Sequences for d3hjua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjua_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlm
gldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgga
iailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsr
nktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskg
ayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtata
SCOPe Domain Coordinates for d3hjua_:
Click to download the PDB-style file with coordinates for d3hjua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hjua_:
- d3hjua_ first appeared in SCOPe 2.05
- d3hjua_ appears in SCOPe 2.07
View in 3D
