Lineage for d3hjna_ (3hjn A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (58 species)
not a true protein
Species Thermotoga maritima [TaxId:243274] [188915] (1 PDB entry) 
Domain d3hjna_: 3hjn A: [177613]
automated match to d4tmka_
complexed with adp, mg, tyd
Details for d3hjna_
PDB Entry: 3hjn (more details), 2.1 Å
PDB Description: Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima
PDB Compounds: (A:) thymidylate kinaseSCOPe Domain Sequences for d3hjna_:
Sequence, based on SEQRES records: (download)
>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee
ihrdvvrevkrr
Sequence, based on observed residues (ATOM records): (download)
>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrknrfekreflervregylvlarehperivvldgkrsieeihr
dvvrevkrr
SCOPe Domain Coordinates for d3hjna_:
Click to download the PDB-style file with coordinates for d3hjna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hjna_:
- d3hjna_ first appeared in SCOPe 2.01
- d3hjna_ appears in SCOPe 2.02
- d3hjna_ appears in SCOPe 2.04
- d3hjna_ appears in the current release, SCOPe 2.08
View in 3D
