Lineage for d3hi4a_ (3hi4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900586Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2900623Protein automated matches [190860] (3 species)
    not a true protein
  7. 2900628Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries)
  8. 2900653Domain d3hi4a_: 3hi4 A: [177594]
    automated match to d1va4a_
    complexed with act, gol, so4

Details for d3hi4a_

PDB Entry: 3hi4 (more details), 2.25 Å

PDB Description: switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase
PDB Compounds: (A:) Arylesterase

SCOPe Domain Sequences for d3hi4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hi4a_ c.69.1.12 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwpldadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

SCOPe Domain Coordinates for d3hi4a_:

Click to download the PDB-style file with coordinates for d3hi4a_.
(The format of our PDB-style files is described here.)

Timeline for d3hi4a_: