Lineage for d3hhhb_ (3hhh B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true familyProtein automated matches [190154] (68 species)
not a true protein
Species Enterococcus faecalis [TaxId:1351] [188913] (1 PDB entry) 
Domain d3hhhb_: 3hhh B: [177575]
automated match to d1xmab_
complexed with gol, so4
Details for d3hhhb_
PDB Entry: 3hhh (more details), 2.7 Å
PDB Description: Crystal structure of transcriptional regulator, a member of PadR family, from Enterococcus faecalis V583
PDB Compounds: (B:) Transcriptional regulator, PadR familySCOPe Domain Sequences for d3hhhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhhb_ a.4.5.0 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkk
SCOPe Domain Coordinates for d3hhhb_:
Click to download the PDB-style file with coordinates for d3hhhb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hhhb_:
- d3hhhb_ first appeared in SCOPe 2.01
- d3hhhb_ appears in SCOPe 2.05
- d3hhhb_ appears in SCOPe 2.07
- d3hhhb_ appears in the current release, SCOPe 2.08
View in 3D
