Lineage for d3hcwa_ (3hcw A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (60 species)
not a true protein
Species Staphylococcus aureus [TaxId:158878] [232454] (1 PDB entry) 
Domain d3hcwa_: 3hcw A: [232455]
automated match to d3k4ha_
complexed with gol
Details for d3hcwa_
PDB Entry: 3hcw (more details), 2.2 Å
PDB Description: crystal structure of probable maltose operon transcriptional repressor malr from staphylococcus areus
PDB Compounds: (A:) Maltose operon transcriptional repressorSCOPe Domain Sequences for d3hcwa_:
Sequence, based on SEQRES records: (download)
>d3hcwa_ c.93.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilknkaqdvielviidtelkirkstqreg
Sequence, based on observed residues (ATOM records): (download)
>d3hcwa_ c.93.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilkndvielviidtelkirkstqreg
SCOPe Domain Coordinates for d3hcwa_:
Click to download the PDB-style file with coordinates for d3hcwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hcwa_:
- d3hcwa_ first appeared in SCOPe 2.03
- d3hcwa_ appears in SCOPe 2.04
- d3hcwa_ is called d3hcwa1 in SCOPe 2.06
- d3hcwa_ appears in the current release, SCOPe 2.08, called d3hcwa1
View in 3D
