Lineage for d3h47a2 (3h47 A:148-219)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-downSuperfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) 
Family a.28.3.0: automated matches [191629] (1 protein)
not a true familyProtein automated matches [191156] (12 species)
not a true protein
Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (4 PDB entries) 
Domain d3h47a2: 3h47 A:148-219 [232390]
Other proteins in same PDB: d3h47a1
automated match to d1e6jp1
Details for d3h47a2
PDB Entry: 3h47 (more details), 1.9 Å
PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (A:) capsid protein p24SCOPe Domain Sequences for d3h47a2:
Sequence, based on SEQRES records: (download)
>d3h47a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
Sequence, based on observed residues (ATOM records): (download)
>d3h47a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraetllvqnanpdcktilkalgpgatleemmtacq
SCOPe Domain Coordinates for d3h47a2:
Click to download the PDB-style file with coordinates for d3h47a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h47a2:
- d3h47a2 first appeared in SCOPe 2.03
- d3h47a2 appears in SCOPe 2.07
View in 3D
