Lineage for d3h30a_ (3h30 A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the commentsProtein Protein kinase CK2, alpha subunit [56142] (3 species)
CMGC group; CK2 subfamily; serine/threonine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [75559] (91 PDB entries) 
Domain d3h30a_: 3h30 A: [177164]
automated match to d1jwha_
complexed with cl, rfz
Details for d3h30a_
PDB Entry: 3h30 (more details), 1.56 Å
PDB Description: crystal structure of the catalytic subunit of human protein kinase ck2 with 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole
PDB Compounds: (A:) Casein kinase II subunit alphaSCOPe Domain Sequences for d3h30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h30a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarm
SCOPe Domain Coordinates for d3h30a_:
Click to download the PDB-style file with coordinates for d3h30a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h30a_:
- d3h30a_ first appeared in SCOPe 2.01
- d3h30a_ appears in SCOPe 2.05
- d3h30a_ appears in SCOPe 2.07
- d3h30a_ appears in the current release, SCOPe 2.08
View in 3D
