Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species) OPK group; AIRK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [90039] (62 PDB entries) |
Domain d3h10a_: 3h10 A: [177142] automated match to d1ol5a_ complexed with 97b |
PDB Entry: 3h10 (more details), 2.2 Å
SCOPe Domain Sequences for d3h10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h10a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl lkhnpsqrpmlrevlehpwitansskps
Timeline for d3h10a_: