Lineage for d3gzxa2 (3gzx A:179-457)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.0: automated matches [191339] (1 protein)
not a true familyProtein automated matches [190218] (22 species)
not a true protein
Species Comamonas testosteroni [TaxId:285] [232354] (2 PDB entries) 
Domain d3gzxa2: 3gzx A:179-457 [232355]
Other proteins in same PDB: d3gzxa1, d3gzxb_
automated match to d1eg9a2
complexed with bnl, fe2, fes, gol, mes
Details for d3gzxa2
PDB Entry: 3gzx (more details), 1.58 Å
PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356
PDB Compounds: (A:) Biphenyl dioxygenase subunit alphaSCOPe Domain Sequences for d3gzxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzxa2 d.129.3.0 (A:179-457) automated matches {Comamonas testosteroni [TaxId: 285]}
eapdlktylsdampymdvmldrteagteaiggiqkwvipcnwkfaaeqfcsdmyhagtms
hlsgvlaglppemdltqiqlskngnqfrsawgghgagwfindssillsvvgpkitqywtq
gpaaekaarrvpqlpildmfgqhmtvfptcsflpgintirtwhprgpnevevwafvlvda
dapedikeefrlqnirtfnaggvfeqddgenwveiqrvmrghkakstslcakmglnvpnk
nnpaypgktayvyaeeaargmyhhwsrmmsepswdtlkp
SCOPe Domain Coordinates for d3gzxa2:
Click to download the PDB-style file with coordinates for d3gzxa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gzxa2:
- d3gzxa2 first appeared in SCOPe 2.03
- d3gzxa2 appears in SCOPe 2.05
- d3gzxa2 appears in SCOPe 2.07
- d3gzxa2 appears in the current release, SCOPe 2.08
View in 3D
