Lineage for d3gzxa1 (3gzx A:18-178)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)Superfamily b.33.1: ISP domain [50022] (4 families) 
Family b.33.1.0: automated matches [191455] (1 protein)
not a true familyProtein automated matches [190701] (13 species)
not a true protein
Species Comamonas testosteroni [TaxId:285] [232352] (2 PDB entries) 
Domain d3gzxa1: 3gzx A:18-178 [232353]
Other proteins in same PDB: d3gzxa2, d3gzxb_
automated match to d1o7na1
complexed with bnl, fe2, fes, gol, mes
Details for d3gzxa1
PDB Entry: 3gzx (more details), 1.58 Å
PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356
PDB Compounds: (A:) Biphenyl dioxygenase subunit alphaSCOPe Domain Sequences for d3gzxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzxa1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp
SCOPe Domain Coordinates for d3gzxa1:
Click to download the PDB-style file with coordinates for d3gzxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gzxa1:
- d3gzxa1 first appeared in SCOPe 2.03
- d3gzxa1 appears in SCOPe 2.07
View in 3D
