Lineage for d3gzja_ (3gzj A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617002Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 1617067Protein automated matches [191073] (1 species)
    not a true protein
  7. 1617068Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries)
  8. 1617076Domain d3gzja_: 3gzj A: [177106]
    automated match to d1y7ha_
    complexed with evs

Details for d3gzja_

PDB Entry: 3gzj (more details), 2.19 Å

PDB Description: crystal structure of polyneuridine aldehyde esterase complexed with 16-epi-vellosimine
PDB Compounds: (A:) Polyneuridine-aldehyde esterase

SCOPe Domain Sequences for d3gzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzja_ c.69.1.20 (A:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdyseplm
evmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfekyn
ekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslff
qdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgmls
qprevckclldisd

SCOPe Domain Coordinates for d3gzja_:

Click to download the PDB-style file with coordinates for d3gzja_.
(The format of our PDB-style files is described here.)

Timeline for d3gzja_: