Lineage for d3gq1a_ (3gq1 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.45: ClpS-like [54735] (1 superfamily)
beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/betaSuperfamily d.45.1: ClpS-like [54736] (3 families) 
Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) Protein automated matches [190034] (3 species)
not a true proteinSpecies Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries) 
Domain d3gq1a_: 3gq1 A: [176901]
automated match to d1mbuc_
complexed with mg
Details for d3gq1a_
PDB Entry: 3gq1 (more details), 1.5 Å
PDB Description: the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide
PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpSSCOPe Domain Sequences for d3gq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gq1a_ d.45.1.2 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd
SCOPe Domain Coordinates for d3gq1a_:
Click to download the PDB-style file with coordinates for d3gq1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gq1a_:
- d3gq1a_ first appeared in SCOPe 2.01
- d3gq1a_ appears in SCOPe 2.06
- d3gq1a_ appears in the current release, SCOPe 2.08
View in 3D
