Lineage for d3gmoa1 (3gmo A:7-185)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
Class I MHC-relatedSpecies Mouse (Mus musculus) [TaxId:10090] [54457] (19 PDB entries) 
Domain d3gmoa1: 3gmo A:7-185 [232296]
Other proteins in same PDB: d3gmoa2, d3gmob_
automated match to d3hujc1
complexed with c8f, edo, nag, plm
Details for d3gmoa1
PDB Entry: 3gmo (more details), 1.6 Å
PDB Description: structure of mouse cd1d in complex with c8phf
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1SCOPe Domain Sequences for d3gmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmoa1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
SCOPe Domain Coordinates for d3gmoa1:
Click to download the PDB-style file with coordinates for d3gmoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gmoa1:
- d3gmoa1 first appeared in SCOPe 2.03
- d3gmoa1 appears in SCOPe 2.05
- d3gmoa1 appears in the current release, SCOPe 2.08
View in 3D
