Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries) |
Domain d3gfpa_: 3gfp A: [246285] automated match to d1fuka_ protein/RNA complex |
PDB Entry: 3gfp (more details), 1.8 Å
SCOPe Domain Sequences for d3gfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gfpa_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvlygklkseghevsi lhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpat yihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkv
Timeline for d3gfpa_: