Lineage for d3geqa_ (3geq A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein c-src tyrosine kinase [56155] (2 species)
PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (39 PDB entries) 
Domain d3geqa_: 3geq A: [210515]
automated match to d2z8ca1
complexed with pp2
Details for d3geqa_
PDB Entry: 3geq (more details), 2.2 Å
PDB Description: structural basis for the chemical rescue of src kinase activity
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase SrcSCOPe Domain Sequences for d3geqa_:
Sequence, based on SEQRES records: (download)
>d3geqa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
aqiasgmayvermnyvhrdlaaanilvgenlvckvadfglarliedneytarqgakfpik
wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
Sequence, based on observed residues (ATOM records): (download)
>d3geqa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
aqiasgmayvermnyvhrdlaaanilvgenlvckvadfglarlpikwtapeaalygrfti
ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
dpeerptfeylqafledyftstepqyqpgenl
SCOPe Domain Coordinates for d3geqa_:
Click to download the PDB-style file with coordinates for d3geqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3geqa_:
- d3geqa_ first appeared in SCOPe 2.03
- d3geqa_ appears in SCOPe 2.04
- d3geqa_ is called d3geqa1 in SCOPe 2.06
- d3geqa_ appears in the current release, SCOPe 2.08, called d3geqa1
View in 3D
