Lineage for d3g7fh2 (3g7f H:37-258)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.41: PRC-barrel domain [50345] (1 superfamily)
core: barrel, partly opened; n*=5, S*=8; meanderSuperfamily b.41.1: PRC-barrel domain [50346] (5 families) 
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) 
Protein automated matches [226918] (3 species)
not a true proteinSpecies Blastochloris viridis [TaxId:1079] [232267] (5 PDB entries) 
Domain d3g7fh2: 3g7f H:37-258 [232268]
Other proteins in same PDB: d3g7fc_, d3g7fh1, d3g7fl_, d3g7fm_
automated match to d1dxrh1
complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant
Details for d3g7fh2
PDB Entry: 3g7f (more details), 2.5 Å
PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center
PDB Compounds: (H:) Photosynthetic reaction center H subunitSCOPe Domain Sequences for d3g7fh2:
Sequence, based on SEQRES records: (download)
>d3g7fh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsd
qfanvprlqsrdqitlreedkvsayyaggllyatperaeall
Sequence, based on observed residues (ATOM records): (download)
>d3g7fh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplvepedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqpt
gnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgve
agtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsdqfanvprl
qsrdqitlreedkvsayyaggllyatperaeall
SCOPe Domain Coordinates for d3g7fh2:
Click to download the PDB-style file with coordinates for d3g7fh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g7fh2:
- d3g7fh2 first appeared in SCOPe 2.03
- d3g7fh2 appears in SCOPe 2.07
View in 3D
