Lineage for d3g6dh2 (3g6d H:123-223)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
Domain d3g6dh2: 3g6d H:123-223 [344723]
Other proteins in same PDB: d3g6da_, d3g6dh1, d3g6dl1, d3g6dl2
complexed with so4
Details for d3g6dh2
PDB Entry: 3g6d (more details), 3.2 Å
PDB Description: Crystal structure of the complex between CNTO607 Fab and IL-13
PDB Compounds: (H:) CNTO607 Fab Heavy chainSCOPe Domain Sequences for d3g6dh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g6dh2 b.1.1.2 (H:123-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
SCOPe Domain Coordinates for d3g6dh2:
Click to download the PDB-style file with coordinates for d3g6dh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g6dh2:
- d3g6dh2 first appeared in SCOPe 2.07
View in 3D
