Lineage for d3g0jb_ (3g0j B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.0: automated matches [191428] (1 protein)
not a true familyProtein automated matches [190615] (14 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) 
Domain d3g0jb_: 3g0j B: [210294]
automated match to d2grca_
complexed with edo, no3
Details for d3g0jb_
PDB Entry: 3g0j (more details), 1.78 Å
PDB Description: Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
PDB Compounds: (B:) Protein polybromo-1SCOPe Domain Sequences for d3g0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0jb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirsh
mmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdl
SCOPe Domain Coordinates for d3g0jb_:
Click to download the PDB-style file with coordinates for d3g0jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g0jb_:
- d3g0jb_ first appeared in SCOPe 2.03
- d3g0jb_ appears in SCOPe 2.06
- d3g0jb_ appears in the current release, SCOPe 2.08
View in 3D
