Lineage for d3fyeb2 (3fye B:130-285)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528013Protein Cytochrome c oxidase [49544] (4 species)
  7. 1528070Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)
  8. 1528073Domain d3fyeb2: 3fye B:130-285 [232211]
    Other proteins in same PDB: d3fyea_, d3fyeb1, d3fyec_, d3fyed1
    automated match to d1m56b1
    complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx

Details for d3fyeb2

PDB Entry: 3fye (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3fyeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fyeb2 b.6.1.2 (B:130-285) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

SCOPe Domain Coordinates for d3fyeb2:

Click to download the PDB-style file with coordinates for d3fyeb2.
(The format of our PDB-style files is described here.)

Timeline for d3fyeb2: