| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
| Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
| Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries) |
| Domain d3fyeb1: 3fye B:30-129 [232210] Other proteins in same PDB: d3fyea_, d3fyeb2, d3fyeb3, d3fyec_, d3fyed2, d3fyed3 automated match to d3dtub2 complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx |
PDB Entry: 3fye (more details), 2.15 Å
SCOPe Domain Sequences for d3fyeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyeb1 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d3fyeb1: