Lineage for d3fwwa2 (3fww A:252-452)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814438Species Yersinia pestis [TaxId:386656] [232199] (1 PDB entry)
  8. 2814439Domain d3fwwa2: 3fww A:252-452 [232200]
    Other proteins in same PDB: d3fwwa1
    automated match to d1hv9a1

Details for d3fwwa2

PDB Entry: 3fww (more details), 2.5 Å

PDB Description: The crystal structure of the bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase from Yersinia pestis CO92
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3fwwa2:

Sequence, based on SEQRES records: (download)

>d3fwwa2 b.81.1.0 (A:252-452) automated matches {Yersinia pestis [TaxId: 386656]}
vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp
ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae
igagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvtrdv
aenelvisrvkqvhiqgwkrp

Sequence, based on observed residues (ATOM records): (download)

>d3fwwa2 b.81.1.0 (A:252-452) automated matches {Yersinia pestis [TaxId: 386656]}
vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp
ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae
igagvnigagtitcnydnkfktiigddvfvgsdtqlvapvtvangatigagttvtrdvae
nelvisrvkqvhiqgwkrp

SCOPe Domain Coordinates for d3fwwa2:

Click to download the PDB-style file with coordinates for d3fwwa2.
(The format of our PDB-style files is described here.)

Timeline for d3fwwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fwwa1