Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Yersinia pestis [TaxId:386656] [232199] (1 PDB entry) |
Domain d3fwwa2: 3fww A:252-452 [232200] Other proteins in same PDB: d3fwwa1 automated match to d1hv9a1 |
PDB Entry: 3fww (more details), 2.5 Å
SCOPe Domain Sequences for d3fwwa2:
Sequence, based on SEQRES records: (download)
>d3fwwa2 b.81.1.0 (A:252-452) automated matches {Yersinia pestis [TaxId: 386656]} vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae igagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvtrdv aenelvisrvkqvhiqgwkrp
>d3fwwa2 b.81.1.0 (A:252-452) automated matches {Yersinia pestis [TaxId: 386656]} vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae igagvnigagtitcnydnkfktiigddvfvgsdtqlvapvtvangatigagttvtrdvae nelvisrvkqvhiqgwkrp
Timeline for d3fwwa2: