Lineage for d3fwgb_ (3fwg B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (121 PDB entries)
Uniprot P00183
Domain d3fwgb_: 3fwg B: [176108]
automated match to d1akda_
complexed with cam, hem, k, trs
Details for d3fwgb_
PDB Entry: 3fwg (more details), 1.55 Å
PDB Description: ferric camphor bound cytochrome p450cam, arg365leu, glu366gln, monoclinic crystal form
PDB Compounds: (B:) Camphor 5-monooxygenaseSCOPe Domain Sequences for d3fwgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwgb_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarlqiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOPe Domain Coordinates for d3fwgb_:
Click to download the PDB-style file with coordinates for d3fwgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fwgb_:
- d3fwgb_ first appeared in SCOPe 2.01
- d3fwgb_ appears in SCOPe 2.07
View in 3D
