Lineage for d3funa2 (3fun A:209-460)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571313Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2571329Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2571330Species Human (Homo sapiens) [TaxId:9606] [64340] (57 PDB entries)
    Uniprot P09960
  8. 2571333Domain d3funa2: 3fun A:209-460 [210177]
    Other proteins in same PDB: d3funa1, d3funa3
    automated match to d1hs6a3
    complexed with 798, act, imd, yb, zn

Details for d3funa2

PDB Entry: 3fun (more details), 1.58 Å

PDB Description: Leukotriene A4 hydrolase in complex with {4-[(2R)-pyrrolidin-2-ylmethoxy]phenyl}(4-thiophen-3-ylphenyl)methanone
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3funa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3funa2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d3funa2:

Click to download the PDB-style file with coordinates for d3funa2.
(The format of our PDB-style files is described here.)

Timeline for d3funa2: