Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries) |
Domain d3ftta_: 3ftt A: [210100] automated match to d3nz2i_ |
PDB Entry: 3ftt (more details), 1.6 Å
SCOPe Domain Sequences for d3ftta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ftta_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]} mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv vrkidndl
Timeline for d3ftta_: