Lineage for d3ftta_ (3ftt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814377Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)
  8. 2814382Domain d3ftta_: 3ftt A: [210100]
    automated match to d3nz2i_

Details for d3ftta_

PDB Entry: 3ftt (more details), 1.6 Å

PDB Description: crystal structure of the galactoside o-acetyltransferase from staphylococcus aureus
PDB Compounds: (A:) Putative acetyltransferase SACOL2570

SCOPe Domain Sequences for d3ftta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ftta_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndl

SCOPe Domain Coordinates for d3ftta_:

Click to download the PDB-style file with coordinates for d3ftta_.
(The format of our PDB-style files is described here.)

Timeline for d3ftta_: