Lineage for d3fpka2 (3fpk A:101-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859820Protein automated matches [226995] (7 species)
    not a true protein
  7. 2859847Species Salmonella typhimurium [TaxId:99287] [225605] (1 PDB entry)
  8. 2859848Domain d3fpka2: 3fpk A:101-248 [210041]
    Other proteins in same PDB: d3fpka1, d3fpkb1
    automated match to d1fdra2
    complexed with ca, fad, mg

Details for d3fpka2

PDB Entry: 3fpk (more details), 1.7 Å

PDB Description: Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3fpka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpka2 c.25.1.1 (A:101-248) automated matches {Salmonella typhimurium [TaxId: 99287]}
devpdcetlwmlatgtaigpylsilqygqdvarfknlvlvhaarfaadlsylplmlelqq
ryegklriqtvvsrenvpgsltgrvpaliengelekavglpmdketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehyw

SCOPe Domain Coordinates for d3fpka2:

Click to download the PDB-style file with coordinates for d3fpka2.
(The format of our PDB-style files is described here.)

Timeline for d3fpka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fpka1