Lineage for d3fhsa2 (3fhs A:84-219)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1492375Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1492376Protein automated matches [226831] (41 species)
    not a true protein
  7. 1492627Species Soybean (Glycine max) [TaxId:3847] [225580] (4 PDB entries)
  8. 1492632Domain d3fhsa2: 3fhs A:84-219 [209929]
    Other proteins in same PDB: d3fhsa1, d3fhsb1
    automated match to d1gwca1
    complexed with gsh

Details for d3fhsa2

PDB Entry: 3fhs (more details), 2.71 Å

PDB Description: Glutathione transferase from Glycine max at 2.7 resolution
PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d3fhsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhsa2 a.45.1.0 (A:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq
kvyefimdlrkklgie

SCOPe Domain Coordinates for d3fhsa2:

Click to download the PDB-style file with coordinates for d3fhsa2.
(The format of our PDB-style files is described here.)

Timeline for d3fhsa2:

1492632
d3fhsa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3fhsa1