Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (29 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225575] (5 PDB entries) |
Domain d3fg0g_: 3fg0 G: [209898] automated match to d4i9ba_ complexed with bme, na, nad |
PDB Entry: 3fg0 (more details), 1.85 Å
SCOPe Domain Sequences for d3fg0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fg0g_ c.82.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 93062]} lyfqsnamellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerail aarrafesgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddih nvfmyfagladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalat gcslvmkpseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftg gietgkhimknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsags rilvqnsikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegat iavggkrpdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqland siyglagavfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegl eeylvskhiltntnpqlvnwfsk
Timeline for d3fg0g_: