Lineage for d3fcda_ (3fcd A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (6 species)
not a true protein
Species Uncultured bacterium [TaxId:77133] [188712] (1 PDB entry) 
Domain d3fcda_: 3fcd A: [175685]
automated match to d1jiea_
Details for d3fcda_
PDB Entry: 3fcd (more details), 1.92 Å
PDB Description: crystal structure of a putative glyoxalase from an environmental bacteria
PDB Compounds: (A:) LyaseSCOPe Domain Sequences for d3fcda_:
Sequence, based on SEQRES records: (download)
>d3fcda_ d.32.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparkiipdgi
arvaicidvsdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapl
aeghhh
Sequence, based on observed residues (ATOM records): (download)
>d3fcda_ d.32.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparvaicidv
sdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftaplaeghhh
SCOPe Domain Coordinates for d3fcda_:
Click to download the PDB-style file with coordinates for d3fcda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fcda_:
- d3fcda_ first appeared in SCOPe 2.01
- d3fcda_ appears in SCOPe 2.03
- d3fcda_ appears in the current release, SCOPe 2.08, called d3fcda1
View in 3D
