Lineage for d3f8fa_ (3f8f A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984389Species Lactococcus lactis [TaxId:416870] [188710] (4 PDB entries)
  8. 1984393Domain d3f8fa_: 3f8f A: [209824]
    automated match to d3f8ca_
    complexed with dm1

Details for d3f8fa_

PDB Entry: 3f8f (more details), 2.2 Å

PDB Description: Crystal structure of multidrug binding transcriptional regulator LmrR complexed with Daunomycin
PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d3f8fa_:

Sequence, based on SEQRES records: (download)

>d3f8fa_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik

Sequence, based on observed residues (ATOM records): (download)

>d3f8fa_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdeggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik

SCOPe Domain Coordinates for d3f8fa_:

Click to download the PDB-style file with coordinates for d3f8fa_.
(The format of our PDB-style files is described here.)

Timeline for d3f8fa_: