Lineage for d3esvg1 (3esv G:-1-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296882Domain d3esvg1: 3esv G:-1-106 [209633]
    automated match to d1h8na1

Details for d3esvg1

PDB Entry: 3esv (more details), 2 Å

PDB Description: crystal structure of the engineered neutralizing antibody m18
PDB Compounds: (G:) Antibody M18 light chain and antibody M18 heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esvg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esvg1 b.1.1.0 (G:-1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ykdiqmtqttsslsaslgdrvtvscrasqdirnylnwyqqkpdgtvkfliyytsrlqpgv
psrfsgsgsgtdysltinnleqedigtyfcqqgntppwtfgggtklei

SCOPe Domain Coordinates for d3esvg1:

Click to download the PDB-style file with coordinates for d3esvg1.
(The format of our PDB-style files is described here.)

Timeline for d3esvg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3esvg2