Lineage for d3esvf2 (3esv F:1002-1113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296881Domain d3esvf2: 3esv F:1002-1113 [209632]
    automated match to d1h8na2

Details for d3esvf2

PDB Entry: 3esv (more details), 2 Å

PDB Description: crystal structure of the engineered neutralizing antibody m18
PDB Compounds: (F:) Antibody M18 light chain and antibody M18 heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esvf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esvf2 b.1.1.0 (F:1002-1113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgpelvkpgasvkisckdsgyafnsswmnwvkqrpgqglewigriypgdgdsnyn
gkfegkailtadkssstaymqlssltsvdsavyfcarsgllryamdywgqgtsvtvss

SCOPe Domain Coordinates for d3esvf2:

Click to download the PDB-style file with coordinates for d3esvf2.
(The format of our PDB-style files is described here.)

Timeline for d3esvf2:

1296881
d3esvf2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3esvf1