Lineage for d3eoda_ (3eod A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838164Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries)
  8. 1838165Domain d3eoda_: 3eod A: [209571]
    automated match to d1peyc_

Details for d3eoda_

PDB Entry: 3eod (more details), 1.75 Å

PDB Description: crystal structure of n-terminal domain of e. coli rssb
PDB Compounds: (A:) Protein hnr

SCOPe Domain Sequences for d3eoda_:

Sequence, based on SEQRES records: (download)

>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiamp
rmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremvfa
cly

Sequence, based on observed residues (ATOM records): (download)

>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiagl
kllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvnrlremvfacly

SCOPe Domain Coordinates for d3eoda_:

Click to download the PDB-style file with coordinates for d3eoda_.
(The format of our PDB-style files is described here.)

Timeline for d3eoda_: