Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries) |
Domain d3eoda_: 3eod A: [209571] automated match to d1peyc_ |
PDB Entry: 3eod (more details), 1.75 Å
SCOPe Domain Sequences for d3eoda_:
Sequence, based on SEQRES records: (download)
>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiamp rmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremvfa cly
>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiagl kllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvnrlremvfacly
Timeline for d3eoda_: