Lineage for d3eo8f_ (3eo8 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917190Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1917191Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1917313Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 1917314Protein automated matches [190672] (21 species)
    not a true protein
  7. 1917333Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries)
  8. 1917344Domain d3eo8f_: 3eo8 F: [196093]
    automated match to d2hayc_
    complexed with act, cl, fmn, gol

Details for d3eo8f_

PDB Entry: 3eo8 (more details), 1.74 Å

PDB Description: crystal structure of blub-like flavoprotein (yp_001089088.1) from clostridium difficile 630 at 1.74 a resolution
PDB Compounds: (F:) BluB-like flavoprotein

SCOPe Domain Sequences for d3eo8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo8f_ d.90.1.0 (F:) automated matches {Clostridium difficile [TaxId: 272563]}
gmelqdtifkrqsvrkfknqdvsdedilkmikaagaapsgkniqnwhfvvikrrdlmeki
advitkkqqeilvemdkvsvdkanrfrkfvknftlfylkapvlvlvftkvynpsgyyele
lidapketidklfirnpgmqslgaaienftlsaielgygscwltsqnyaadeieavleae
tgfekgeyflgamlalgvpednlkspskkpveeictfik

SCOPe Domain Coordinates for d3eo8f_:

Click to download the PDB-style file with coordinates for d3eo8f_.
(The format of our PDB-style files is described here.)

Timeline for d3eo8f_: