Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (21 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries) |
Domain d3eo8f_: 3eo8 F: [196093] automated match to d2hayc_ complexed with act, cl, fmn, gol |
PDB Entry: 3eo8 (more details), 1.74 Å
SCOPe Domain Sequences for d3eo8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo8f_ d.90.1.0 (F:) automated matches {Clostridium difficile [TaxId: 272563]} gmelqdtifkrqsvrkfknqdvsdedilkmikaagaapsgkniqnwhfvvikrrdlmeki advitkkqqeilvemdkvsvdkanrfrkfvknftlfylkapvlvlvftkvynpsgyyele lidapketidklfirnpgmqslgaaienftlsaielgygscwltsqnyaadeieavleae tgfekgeyflgamlalgvpednlkspskkpveeictfik
Timeline for d3eo8f_: