Lineage for d3elkb_ (3elk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984649Species Thermoplasma acidophilum [TaxId:2303] [196079] (1 PDB entry)
  8. 1984651Domain d3elkb_: 3elk B: [196080]
    automated match to d3hhha_
    complexed with cl

Details for d3elkb_

PDB Entry: 3elk (more details), 1.7 Å

PDB Description: crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum
PDB Compounds: (B:) Putative transcriptional regulator TA0346

SCOPe Domain Sequences for d3elkb_:

Sequence, based on SEQRES records: (download)

>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
erilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvises
svnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Sequence, based on observed residues (ATOM records): (download)

>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
erilhglitlyilkelvkrpmhgyelqksmfettgqalpgsiyillktmkergfvisess
vnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

SCOPe Domain Coordinates for d3elkb_:

Click to download the PDB-style file with coordinates for d3elkb_.
(The format of our PDB-style files is described here.)

Timeline for d3elkb_: