Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries) |
Domain d3eina1: 3ein A:2-85 [209504] Other proteins in same PDB: d3eina2 automated match to d1jlva2 complexed with gsh |
PDB Entry: 3ein (more details), 1.13 Å
SCOPe Domain Sequences for d3eina1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eina1 c.47.1.0 (A:2-85) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vdfyylpgsspcrsvimtakavgvelnkkllnlqagehlkpeflkinpqhtiptlvdngf alwesraiqvylvekygktdslyp
Timeline for d3eina1: