Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species) |
Species Neisseria meningitidis [TaxId:491] [188964] (1 PDB entry) |
Domain d3eeia_: 3eei A: [174891] automated match to d1nc1b_ complexed with mtm |
PDB Entry: 3eei (more details), 1.78 Å
SCOPe Domain Sequences for d3eeia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eeia_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Neisseria meningitidis [TaxId: 491]} lktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaavat awiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlparf asdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaaai aqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl
Timeline for d3eeia_: