Lineage for d3e5na2 (3e5n A:140-360)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) 
Family d.142.1.0: automated matches [227184] (1 protein)
not a true familyProtein automated matches [226904] (32 species)
not a true protein
Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries) 
Domain d3e5na2: 3e5n A:140-360 [209387]
Other proteins in same PDB: d3e5na1
automated match to d1ehib2
Details for d3e5na2
PDB Entry: 3e5n (more details), 2 Å
PDB Description: crystal structure of d-alanine-d-alanine ligase from xanthomonas oryzae pv. oryzae kacc10331
PDB Compounds: (A:) D-alanine-D-alanine ligase ASCOPe Domain Sequences for d3e5na2:
Sequence, based on SEQRES records: (download)
>d3e5na2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqll
Sequence, based on observed residues (ATOM records): (download)
>d3e5na2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqll
SCOPe Domain Coordinates for d3e5na2:
Click to download the PDB-style file with coordinates for d3e5na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e5na2:
- d3e5na2 first appeared in SCOPe 2.03
- d3e5na2 appears in SCOPe 2.05
- d3e5na2 appears in SCOPe 2.07
- d3e5na2 appears in the current release, SCOPe 2.08
View in 3D
