Lineage for d3e5na1 (3e5n A:2-139)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843027Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1843028Protein automated matches [226903] (28 species)
    not a true protein
  7. 1843153Species Xanthomonas oryzae [TaxId:342109] [225704] (4 PDB entries)
  8. 1843154Domain d3e5na1: 3e5n A:2-139 [209386]
    Other proteins in same PDB: d3e5na2
    automated match to d1ehib1

Details for d3e5na1

PDB Entry: 3e5n (more details), 2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from xanthomonas oryzae pv. oryzae kacc10331
PDB Compounds: (A:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3e5na1:

Sequence, based on SEQRES records: (download)

>d3e5na1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllr
manlpfvgsgvlgsavam

Sequence, based on observed residues (ATOM records): (download)

>d3e5na1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
nlpfvgsgvlgsavam

SCOPe Domain Coordinates for d3e5na1:

Click to download the PDB-style file with coordinates for d3e5na1.
(The format of our PDB-style files is described here.)

Timeline for d3e5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e5na2