Lineage for d3dzza_ (3dzz A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.0: automated matches [191328] (1 protein)
not a true familyProtein automated matches [190151] (121 species)
not a true protein
Species Lactobacillus delbrueckii [TaxId:321956] [188555] (1 PDB entry) 
Domain d3dzza_: 3dzz A: [174419]
automated match to d1c7na_
complexed with act, ca, cl, peg, pg4
Details for d3dzza_
PDB Entry: 3dzz (more details), 1.61 Å
PDB Description: crystal structure of a putative plp-dependent aminotransferase (lbul_1103) from lactobacillus delbrueckii subsp. at 1.61 a resolution
PDB Compounds: (A:) putative pyridoxal 5'-phosphate-dependent C-S lyaseSCOPe Domain Sequences for d3dzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dzza_ c.67.1.0 (A:) automated matches {Lactobacillus delbrueckii [TaxId: 321956]}
kqydfthvpkrqgnsikwgvlkekelpmwiaemdfkiapeimasmeeklkvaafgyesvp
aeyykavadweeiehrarpkedwcvfasgvvpaisamvrqftspgdqilvqepvynmfys
viegngrrvissdliyenskysvnwadleeklatpsvrmmvfcnphnpigyawseeevkr
iaelcakhqvllisdeihgdlvltdeditpaftvdwdaknwvvslispsktfnlaalhaa
caiipnpdlraraeesfflagigepnllaipaaiaayeeghdwlrelkqvlrdnfayare
flakevpevkvldsnasylawvdisalgmnaedfckylrektgliisagngyrgnghefv
rinlacpkelvidgmqrlkqgvlnln
SCOPe Domain Coordinates for d3dzza_:
Click to download the PDB-style file with coordinates for d3dzza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dzza_:
- d3dzza_ first appeared in SCOPe 2.01
- d3dzza_ appears in SCOPe 2.05
- d3dzza_ appears in SCOPe 2.07
- d3dzza_ appears in the current release, SCOPe 2.08
View in 3D
