Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Lactobacillus delbrueckii [TaxId:321956] [188555] (1 PDB entry) |
Domain d3dzza_: 3dzz A: [174419] automated match to d1c7na_ complexed with act, ca, cl, peg, pg4 |
PDB Entry: 3dzz (more details), 1.61 Å
SCOPe Domain Sequences for d3dzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dzza_ c.67.1.0 (A:) automated matches {Lactobacillus delbrueckii [TaxId: 321956]} kqydfthvpkrqgnsikwgvlkekelpmwiaemdfkiapeimasmeeklkvaafgyesvp aeyykavadweeiehrarpkedwcvfasgvvpaisamvrqftspgdqilvqepvynmfys viegngrrvissdliyenskysvnwadleeklatpsvrmmvfcnphnpigyawseeevkr iaelcakhqvllisdeihgdlvltdeditpaftvdwdaknwvvslispsktfnlaalhaa caiipnpdlraraeesfflagigepnllaipaaiaayeeghdwlrelkqvlrdnfayare flakevpevkvldsnasylawvdisalgmnaedfckylrektgliisagngyrgnghefv rinlacpkelvidgmqrlkqgvlnln
Timeline for d3dzza_: