Lineage for d3dr8b_ (3dr8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968815Species Salmonella typhimurium [TaxId:90371] [188554] (2 PDB entries)
  8. 2968820Domain d3dr8b_: 3dr8 B: [174203]
    automated match to d2bl1a1
    complexed with aco, act, cl

Details for d3dr8b_

PDB Entry: 3dr8 (more details), 1.95 Å

PDB Description: structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
PDB Compounds: (B:) yncA

SCOPe Domain Sequences for d3dr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr8b_ d.108.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
namtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvsee
ngvvtgyasfgdwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmva
giesqnaasirlhhslgftvtaqmpqvgvkfgrwldltfmqlqldehaapdac

SCOPe Domain Coordinates for d3dr8b_:

Click to download the PDB-style file with coordinates for d3dr8b_.
(The format of our PDB-style files is described here.)

Timeline for d3dr8b_: