Lineage for d3dplr_ (3dpl R:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1966943Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1966944Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1966945Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 1966977Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 1966978Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 1966979Domain d3dplr_: 3dpl R: [157824]
    automated match to d1ldjb_
    complexed with zn

Details for d3dplr_

PDB Entry: 3dpl (more details), 2.6 Å

PDB Description: structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation.
PDB Compounds: (R:) RING-box protein 1

SCOPe Domain Sequences for d3dplr_:

Sequence, based on SEQRES records: (download)

>d3dplr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqkygh

Sequence, based on observed residues (ATOM records): (download)

>d3dplr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf
hcisrwlktrqvcpldnrewefqkygh

SCOPe Domain Coordinates for d3dplr_:

Click to download the PDB-style file with coordinates for d3dplr_.
(The format of our PDB-style files is described here.)

Timeline for d3dplr_: