Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d3difc2: 3dif C:108-214 [199239] Other proteins in same PDB: d3difa1, d3difb1, d3difc1, d3difd1 automated match to d1dqdl2 |
PDB Entry: 3dif (more details), 2.4 Å
SCOPe Domain Sequences for d3difc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3difc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3difc2:
View in 3D Domains from other chains: (mouse over for more information) d3difa1, d3difa2, d3difb1, d3difd1 |