Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Anabaena variabilis [TaxId:240292] [188517] (1 PDB entry) |
Domain d3dfeb_: 3dfe B: [173887] automated match to d2cz4a1 complexed with edo, ipa |
PDB Entry: 3dfe (more details), 2.35 Å
SCOPe Domain Sequences for d3dfeb_:
Sequence, based on SEQRES records: (download)
>d3dfeb_ d.58.5.0 (B:) automated matches {Anabaena variabilis [TaxId: 240292]} mskranklvivtekvllkkvakiieeagatgytvvdtggkgsrnvrstgkpntsdtdsnv kfevltenremaekiadqvaikfftdyagiiyiceaevlyg
>d3dfeb_ d.58.5.0 (B:) automated matches {Anabaena variabilis [TaxId: 240292]} mskranklvivtekvllkkvakiieeagatgytvvdtggsnvkfevltenremaekiadq vaikfftdyagiiyiceaevlyg
Timeline for d3dfeb_: