Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [188656] (1 PDB entry) |
Domain d3dbja_: 3dbj A: [173798] automated match to d1kn1a_ complexed with cyc |
PDB Entry: 3dbj (more details), 2.9 Å
SCOPe Domain Sequences for d3dbja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbja_ a.1.1.3 (A:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt pipavaegiramknvacsllsaedaaeagsyfdfvigamq
Timeline for d3dbja_: