Lineage for d3d4ub2 (3d4u B:38-74)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3033045Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)
  6. 3033046Protein Carboxypeptidase inhibitor [161136] (1 species)
    consists of two structurally similar to beta-defensin domains
  7. 3033047Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
    Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96
  8. 3033049Domain d3d4ub2: 3d4u B:38-74 [157301]
    Other proteins in same PDB: d3d4ua_
    complexed with act, so4, zn

Details for d3d4ub2

PDB Entry: 3d4u (more details), 1.7 Å

PDB Description: Bovine thrombin-activatable fibrinolysis inhibitor (TAFIa) in complex with tick-derived carboxypeptidase inhibitor.
PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d3d4ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d4ub2 g.9.1.3 (B:38-74) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
tgckgkggecnpldrqckelqaesascgkgqkccvwl

SCOPe Domain Coordinates for d3d4ub2:

Click to download the PDB-style file with coordinates for d3d4ub2.
(The format of our PDB-style files is described here.)

Timeline for d3d4ub2:

3033049
d3d4ub2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3d4ub1
3033049
d3d4ub2 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3d4ua_